PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_004490703.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Cicereae; Cicer
Family LBD
Protein Properties Length: 230aa    MW: 25244.4 Da    PI: 7.4637
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_004490703.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.85.7e-41411401100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++C+++pyf  ++p+kfa+vhk+FGasnv+kll ++pe +r da++s+vyeA+ r+rdP+yG++g i++lqqq+++l+ael+
  XP_004490703.1  41 PCAACKLLRRRCAEECPFSPYFSPHEPQKFAAVHKVFGASNVSKLLMEVPEGQRGDAANSMVYEANLRLRDPIYGCMGAISSLQQQVQSLQAELQ 135
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_004490703.1 136 AIRAE 140
                     99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.07640141IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-4141138IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MFGCQETERL DELEKVNSEG ETSLQMGRKH FYGTTLNTVT PCAACKLLRR RCAEECPFSP  60
YFSPHEPQKF AAVHKVFGAS NVSKLLMEVP EGQRGDAANS MVYEANLRLR DPIYGCMGAI  120
SSLQQQVQSL QAELQAIRAE ILKYKYREAT NFISSNHSTL VSSMPNSTQN SSQPLSSSSS  180
SLPLPKLLPS HESIILSSLS SSSASNSVYT SNKSTMSHGS ISSENIPYFV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1438891e-120BT143889.1 Medicago truncatula clone JCVI-FLMt-13L16 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004490703.11e-169PREDICTED: LOB domain-containing protein 13 isoform X2
SwissprotQ9AT612e-73LBD13_ARATH; LOB domain-containing protein 13
TrEMBLG7KFM61e-103G7KFM6_MEDTR; LOB domain protein
STRINGGLYMA14G38280.21e-100(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30340.18e-63LOB domain-containing protein 13